SSL Report: admin.srirameshwarmahadevmandirvikasnyas.in (190.92.174.109)
Assessed on:  Thu, 19 Jun 2025 14:38:26 UTC | Clear cache

Due to a recently discovered bug in Apple's code, your browser is exposed to MITM attacks. Click here for more information.

Summary
Overall Rating
B
0
20
40
60
80
100
Certificate
 
Protocol Support
 
Key Exchange
 
Cipher Strength
 

Visit our documentation page for more information, configuration guides, and books. Known issues are documented here.
This server supports TLS 1.0 and TLS 1.1. Grade capped to B. MORE INFO »
This site works only in browsers with SNI support.
This server supports TLS 1.3.  MORE INFO »
Certificate #1: RSA 2048 bits (SHA256withRSA)
Server Key and Certificate #1
Subject admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=
Common names admin.srirameshwarmahadevmandirvikasnyas.in
Alternative names admin.srirameshwarmahadevmandirvikasnyas.in
Serial Number 05a73d1c89a9b9ea6f71f2a5a9a71039f3ca
Valid from Sun, 15 Jun 2025 05:47:26 UTC
Valid until Sat, 13 Sep 2025 05:47:25 UTC (expires in 2 months and 24 days)
Key RSA 2048 bits (e 65537)
Weak key (Debian) No
Issuer R10
AIA: http://r10.i.lencr.org/
Signature algorithm SHA256withRSA
Extended Validation No
Certificate Transparency Yes (certificate)
OCSP Must Staple No
Revocation information CRL
CRL: http://r10.c.lencr.org/75.crl
Revocation status Good (not revoked)
DNS CAA No (more info)
Trusted Yes
Mozilla  Apple  Android  Java  Windows 


Additional Certificates (if supplied)
Certificates provided 2 (2622 bytes)
Chain issues None
#2
Subject R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=
Valid until Fri, 12 Mar 2027 23:59:59 UTC (expires in 1 year and 8 months)
Key RSA 2048 bits (e 65537)
Issuer ISRG Root X1
Signature algorithm SHA256withRSA


Certification Paths
Path #1: Trusted
1 Sent by server admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=

RSA 2048 bits (e 65537) / SHA256withRSA
3 In trust store ISRG Root X1   Self-signed
Fingerprint SHA256: 96bcec06264976f37460779acf28c5a7cfe8a3c0aae11a8ffcee05c0bddf08c6
Pin SHA256: C5+lpZ7tcVwmwQIMcRtPbsQtWLABXhQzejna0wHFr8M=

RSA 4096 bits (e 65537) / SHA256withRSA
Path #1: Trusted
1 Sent by server admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=

RSA 2048 bits (e 65537) / SHA256withRSA
3 In trust store ISRG Root X1   Self-signed
Fingerprint SHA256: 96bcec06264976f37460779acf28c5a7cfe8a3c0aae11a8ffcee05c0bddf08c6
Pin SHA256: C5+lpZ7tcVwmwQIMcRtPbsQtWLABXhQzejna0wHFr8M=

RSA 4096 bits (e 65537) / SHA256withRSA
Path #1: Trusted
1 Sent by server admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=

RSA 2048 bits (e 65537) / SHA256withRSA
3 In trust store ISRG Root X1   Self-signed
Fingerprint SHA256: 96bcec06264976f37460779acf28c5a7cfe8a3c0aae11a8ffcee05c0bddf08c6
Pin SHA256: C5+lpZ7tcVwmwQIMcRtPbsQtWLABXhQzejna0wHFr8M=

RSA 4096 bits (e 65537) / SHA256withRSA
Path #1: Trusted
1 Sent by server admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=

RSA 2048 bits (e 65537) / SHA256withRSA
3 In trust store ISRG Root X1   Self-signed
Fingerprint SHA256: 96bcec06264976f37460779acf28c5a7cfe8a3c0aae11a8ffcee05c0bddf08c6
Pin SHA256: C5+lpZ7tcVwmwQIMcRtPbsQtWLABXhQzejna0wHFr8M=

RSA 4096 bits (e 65537) / SHA256withRSA
Path #1: Trusted
1 Sent by server admin.srirameshwarmahadevmandirvikasnyas.in
Fingerprint SHA256: 3db05a3ab5b3e3384c66c8d5ba737d182c36afef4ce6a5f5486f0273945a038b
Pin SHA256: goHZl61Yw1jcA8dppEc5KiPmIGyPNd2NFf1WL2OScOY=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server R10
Fingerprint SHA256: 9d7c3f1aa6ad2b2ec0d5cf1e246f8d9ae6cbc9fd0755ad37bb974b1f2fb603f3
Pin SHA256: K7rZOrXHknnsEhUH8nLL4MZkejquUuIvOIr6tCa0rbo=

RSA 2048 bits (e 65537) / SHA256withRSA
3 In trust store ISRG Root X1   Self-signed
Fingerprint SHA256: 96bcec06264976f37460779acf28c5a7cfe8a3c0aae11a8ffcee05c0bddf08c6
Pin SHA256: C5+lpZ7tcVwmwQIMcRtPbsQtWLABXhQzejna0wHFr8M=

RSA 4096 bits (e 65537) / SHA256withRSA

Click here to expand

Certificate #2: RSA 2048 bits (SHA256withRSA)
Server Key and Certificate #1
Subject whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=
Common names whgi.net
Alternative names whgi.net *.bom1.mysecurecloudhost.com *.bom1.stableserver.net *.can1.mysecurecloudhost.com *.can1.stableserver.net *.col1.mysecurecloudhost.com *.col1.stableserver.net *.dxb1.mysecurecloudhost.com *.dxb1.stableserver.net *.fra1.mysecurecloudhost.com *.fra1.stableserver.net *.lon1.mysecurecloudhost.com *.lon1.stableserver.net *.lux1.mysecurecloudhost.com *.lux1.stableserver.net *.mex1.mysecurecloudhost.com *.mex1.stableserver.net *.mysecurecloudhost.com *.sgp1.mysecurecloudhost.com *.sgp1.stableserver.net *.stableserver.net *.syd1.mysecurecloudhost.com *.syd1.stableserver.net *.usc1.mysecurecloudhost.com *.usc1.stableserver.net *.use1.mysecurecloudhost.com *.use1.stableserver.net *.whgi.net   MISMATCH
Serial Number 6aa5770f973d78f93d549f7480ebde80
Valid from Tue, 20 May 2025 00:00:00 UTC
Valid until Fri, 19 Jun 2026 23:59:59 UTC (expires in 1 year)
Key RSA 2048 bits (e 65537)
Weak key (Debian) No
Issuer Sectigo RSA Domain Validation Secure Server CA
AIA: http://crt.sectigo.com/SectigoRSADomainValidationSecureServerCA.crt
Signature algorithm SHA256withRSA
Extended Validation No
Certificate Transparency Yes (certificate)
OCSP Must Staple No
Revocation information OCSP
OCSP: http://ocsp.sectigo.com
Revocation status Good (not revoked)
Trusted No   NOT TRUSTED
Mozilla  Apple  Android  Java  Windows 


Additional Certificates (if supplied)
Certificates provided 3 (5262 bytes)
Chain issues None
#2
Subject Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=
Valid until Tue, 31 Dec 2030 23:59:59 UTC (expires in 5 years and 6 months)
Key RSA 2048 bits (e 65537)
Issuer USERTrust RSA Certification Authority
Signature algorithm SHA384withRSA
#3
Subject USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=
Valid until Sun, 31 Dec 2028 23:59:59 UTC (expires in 3 years and 6 months)
Key RSA 4096 bits (e 65537)
Issuer AAA Certificate Services
Signature algorithm SHA384withRSA


Certification Paths
Path #1: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 In trust store USERTrust RSA Certification Authority   Self-signed
Fingerprint SHA256: e793c9b02fd8aa13e21c31228accb08119643b749c898964b1746d46c3d4cbd2
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
Path #2: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 Sent by server USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
4 In trust store AAA Certificate Services   Self-signed
Fingerprint SHA256: d7a7a0fb5d7e2731d771e9484ebcdef71d5f0c3e0a2948782bc83ee0ea699ef4
Pin SHA256: vRU+17BDT2iGsXvOi76E7TQMcTLXAqj0+jGPdW7L1vM=

RSA 2048 bits (e 65537) / SHA1withRSA
Weak or insecure signature, but no impact on root certificate
Path #1: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 In trust store USERTrust RSA Certification Authority   Self-signed
Fingerprint SHA256: e793c9b02fd8aa13e21c31228accb08119643b749c898964b1746d46c3d4cbd2
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
Path #2: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 Sent by server USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
4 In trust store AAA Certificate Services   Self-signed
Fingerprint SHA256: d7a7a0fb5d7e2731d771e9484ebcdef71d5f0c3e0a2948782bc83ee0ea699ef4
Pin SHA256: vRU+17BDT2iGsXvOi76E7TQMcTLXAqj0+jGPdW7L1vM=

RSA 2048 bits (e 65537) / SHA1withRSA
Weak or insecure signature, but no impact on root certificate
Path #1: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 In trust store USERTrust RSA Certification Authority   Self-signed
Fingerprint SHA256: e793c9b02fd8aa13e21c31228accb08119643b749c898964b1746d46c3d4cbd2
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
Path #2: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 Sent by server USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
4 In trust store AAA Certificate Services   Self-signed
Fingerprint SHA256: d7a7a0fb5d7e2731d771e9484ebcdef71d5f0c3e0a2948782bc83ee0ea699ef4
Pin SHA256: vRU+17BDT2iGsXvOi76E7TQMcTLXAqj0+jGPdW7L1vM=

RSA 2048 bits (e 65537) / SHA1withRSA
Weak or insecure signature, but no impact on root certificate
Path #1: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 In trust store USERTrust RSA Certification Authority   Self-signed
Fingerprint SHA256: e793c9b02fd8aa13e21c31228accb08119643b749c898964b1746d46c3d4cbd2
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
Path #2: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 Sent by server USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
4 In trust store AAA Certificate Services   Self-signed
Fingerprint SHA256: d7a7a0fb5d7e2731d771e9484ebcdef71d5f0c3e0a2948782bc83ee0ea699ef4
Pin SHA256: vRU+17BDT2iGsXvOi76E7TQMcTLXAqj0+jGPdW7L1vM=

RSA 2048 bits (e 65537) / SHA1withRSA
Weak or insecure signature, but no impact on root certificate
Path #1: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 In trust store USERTrust RSA Certification Authority   Self-signed
Fingerprint SHA256: e793c9b02fd8aa13e21c31228accb08119643b749c898964b1746d46c3d4cbd2
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
Path #2: Not trusted (invalid certificate [Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687])
1 Sent by server whgi.net
Fingerprint SHA256: 86a446d0bb5dd637212f1024553c16b15a57b35100b884a15202417b23711687
Pin SHA256: uhisCaaU8WOgnEwF7XsgMaOOrs6qnwAfbdoPlIP4pYg=

RSA 2048 bits (e 65537) / SHA256withRSA
2 Sent by server Sectigo RSA Domain Validation Secure Server CA
Fingerprint SHA256: 7fa4ff68ec04a99d7528d5085f94907f4d1dd1c5381bacdc832ed5c960214676
Pin SHA256: 4a6cPehI7OG6cuDZka5NDZ7FR8a60d3auda+sKfg4Ng=

RSA 2048 bits (e 65537) / SHA384withRSA
3 Sent by server USERTrust RSA Certification Authority
Fingerprint SHA256: 68b9c761219a5b1f0131784474665db61bbdb109e00f05ca9f74244ee5f5f52b
Pin SHA256: x4QzPSC810K5/cMjb05Qm4k3Bw5zBn4lTdO/nEW/Td4=

RSA 4096 bits (e 65537) / SHA384withRSA
4 In trust store AAA Certificate Services   Self-signed
Fingerprint SHA256: d7a7a0fb5d7e2731d771e9484ebcdef71d5f0c3e0a2948782bc83ee0ea699ef4
Pin SHA256: vRU+17BDT2iGsXvOi76E7TQMcTLXAqj0+jGPdW7L1vM=

RSA 2048 bits (e 65537) / SHA1withRSA
Weak or insecure signature, but no impact on root certificate

Click here to expand

Click here to expand

Configuration
Protocols
TLS 1.3 Yes
TLS 1.2 Yes*
TLS 1.1 Yes
TLS 1.0 Yes*
SSL 3 No
SSL 2 No
(*) Experimental: Server negotiated using No-SNI


Cipher Suites
# TLS 1.3 (suites in server-preferred order)
TLS_AES_256_GCM_SHA384 (0x1302)   ECDH secp384r1 (eq. 7680 bits RSA)   FS 256
TLS_AES_128_GCM_SHA256 (0x1301)   ECDH x25519 (eq. 3072 bits RSA)   FS 128
# TLS 1.2 (suites in server-preferred order)
TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (0xc030)   ECDH secp384r1 (eq. 7680 bits RSA)   FS 256
TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (0xc02f)   ECDH x25519 (eq. 3072 bits RSA)   FS 128
TLS_DHE_RSA_WITH_AES_256_GCM_SHA384 (0x9f)   DH 2048 bits   FS 256
TLS_DHE_RSA_WITH_AES_128_GCM_SHA256 (0x9e)   DH 2048 bits   FS 128
TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384 (0xc028)   ECDH secp384r1 (eq. 7680 bits RSA)   FS   WEAK 256
TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256 (0xc027)   ECDH x25519 (eq. 3072 bits RSA)   FS   WEAK 128
TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA (0xc014)   ECDH secp384r1 (eq. 7680 bits RSA)   FS   WEAK 256
TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA (0xc013)   ECDH x25519 (eq. 3072 bits RSA)   FS   WEAK 128
TLS_RSA_WITH_AES_256_GCM_SHA384 (0x9d)   WEAK 256
TLS_RSA_WITH_AES_128_GCM_SHA256 (0x9c)   WEAK 128
TLS_RSA_WITH_AES_256_CBC_SHA256 (0x3d)   WEAK 256
TLS_RSA_WITH_AES_128_CBC_SHA256 (0x3c)   WEAK 128
TLS_RSA_WITH_AES_256_CBC_SHA (0x35)   WEAK 256
TLS_RSA_WITH_AES_128_CBC_SHA (0x2f)   WEAK 128
TLS_RSA_WITH_3DES_EDE_CBC_SHA (0xa)   WEAK 112
# TLS 1.1 (suites in server-preferred order)
TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA (0xc014)   ECDH secp384r1 (eq. 7680 bits RSA)   FS   WEAK 256
TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA (0xc013)   ECDH x25519 (eq. 3072 bits RSA)   FS   WEAK 128
TLS_RSA_WITH_AES_256_CBC_SHA (0x35)   WEAK 256
TLS_RSA_WITH_AES_128_CBC_SHA (0x2f)   WEAK 128
TLS_RSA_WITH_3DES_EDE_CBC_SHA (0xa)   WEAK 112
# TLS 1.0 (suites in server-preferred order)
TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA (0xc014)   ECDH secp384r1 (eq. 7680 bits RSA)   FS   WEAK 256
TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA (0xc013)   ECDH x25519 (eq. 3072 bits RSA)   FS   WEAK 128
TLS_RSA_WITH_AES_256_CBC_SHA (0x35)   WEAK 256
TLS_RSA_WITH_AES_128_CBC_SHA (0x2f)   WEAK 128
TLS_RSA_WITH_3DES_EDE_CBC_SHA (0xa)   WEAK 112


Handshake Simulation
Android 2.3.7   No SNI 2 Incorrect certificate because this client doesn't support SNI
RSA 2048 (SHA256)   |  TLS 1.0  |  TLS_RSA_WITH_AES_128_CBC_SHA
Android 4.0.4 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Android 4.1.1 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Android 4.2.2 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Android 4.3 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Android 4.4.2 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Android 5.0.0 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256   ECDH secp256r1  FS
Android 6.0 RSA 2048 (SHA256)   TLS 1.2 > http/1.1   TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256   ECDH secp256r1  FS
Android 7.0 RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Android 8.0 RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Android 8.1 -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Android 9.0 -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Baidu Jan 2015 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
BingPreview Jan 2015 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Chrome 49 / XP SP3 RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256   ECDH secp256r1  FS
Chrome 69 / Win 7  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Chrome 70 / Win 10 -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Chrome 80 / Win 10  R -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Firefox 31.3.0 ESR / Win 7 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256   ECDH secp256r1  FS
Firefox 47 / Win 7  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256   ECDH secp256r1  FS
Firefox 49 / XP SP3 RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Firefox 62 / Win 7  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Firefox 73 / Win 10  R -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Googlebot Feb 2018 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
IE 7 / Vista RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
IE 8 / XP   No FS 1   No SNI 2 Incorrect certificate because this client doesn't support SNI
RSA 2048 (SHA256)   |  TLS 1.0  |  TLS_RSA_WITH_3DES_EDE_CBC_SHA
IE 8-10 / Win 7  R RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
IE 11 / Win 7  R RSA 2048 (SHA256)   TLS 1.2 TLS_DHE_RSA_WITH_AES_256_GCM_SHA384   DH 2048  FS
IE 11 / Win 8.1  R RSA 2048 (SHA256)   TLS 1.2 > http/1.1   TLS_DHE_RSA_WITH_AES_256_GCM_SHA384   DH 2048  FS
IE 10 / Win Phone 8.0 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
IE 11 / Win Phone 8.1  R RSA 2048 (SHA256)   TLS 1.2 > http/1.1   TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256   ECDH secp256r1  FS
IE 11 / Win Phone 8.1 Update  R RSA 2048 (SHA256)   TLS 1.2 > http/1.1   TLS_DHE_RSA_WITH_AES_256_GCM_SHA384   DH 2048  FS
IE 11 / Win 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Edge 15 / Win 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Edge 16 / Win 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Edge 18 / Win 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Edge 13 / Win Phone 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Java 6u45   No SNI 2 Incorrect certificate because this client doesn't support SNI
RSA 2048 (SHA256)   |  TLS 1.0  |  TLS_RSA_WITH_AES_128_CBC_SHA
Java 7u25 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA   ECDH secp256r1  FS
Java 8u161 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Java 11.0.3 -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Java 12.0.1 -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
OpenSSL 0.9.8y RSA 2048 (SHA256)   TLS 1.0 TLS_RSA_WITH_AES_256_CBC_SHA  No FS
OpenSSL 1.0.1l  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
OpenSSL 1.0.2s  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
OpenSSL 1.1.0k  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
OpenSSL 1.1.1c  R -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 5.1.9 / OS X 10.6.8 RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Safari 6 / iOS 6.0.1 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384   ECDH secp384r1  FS
Safari 6.0.4 / OS X 10.8.4  R RSA 2048 (SHA256)   TLS 1.0 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA   ECDH secp384r1  FS
Safari 7 / iOS 7.1  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384   ECDH secp384r1  FS
Safari 7 / OS X 10.9  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384   ECDH secp384r1  FS
Safari 8 / iOS 8.4  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384   ECDH secp384r1  FS
Safari 8 / OS X 10.10  R RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384   ECDH secp384r1  FS
Safari 9 / iOS 9  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 9 / OS X 10.11  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 10 / iOS 10  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 10 / OS X 10.12  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 12.1.2 / MacOS 10.14.6 Beta  R -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Safari 12.1.1 / iOS 12.3.1  R -   TLS 1.3 TLS_AES_256_GCM_SHA384   ECDH secp384r1  FS
Apple ATS 9 / iOS 9  R RSA 2048 (SHA256)   TLS 1.2 > h2   TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
Yahoo Slurp Jan 2015 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
YandexBot Jan 2015 RSA 2048 (SHA256)   TLS 1.2 TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384   ECDH secp384r1  FS
# Not simulated clients (Protocol mismatch)
IE 6 / XP   No FS 1   No SNI 2 Protocol mismatch (not simulated)

Click here to expand

(1) Clients that do not support Forward Secrecy (FS) are excluded when determining support for it.
(2) No support for virtual SSL hosting (SNI). Connects to the default site if the server uses SNI.
(3) Only first connection attempt simulated. Browsers sometimes retry with a lower protocol version.
(R) Denotes a reference browser or client, with which we expect better effective security.
(All) We use defaults, but some platforms do not use their best protocols and features (e.g., Java 6 & 7, older IE).
(All) Certificate trust is not checked in handshake simulation, we only perform TLS handshake.


Protocol Details
Secure Renegotiation Supported
Secure Client-Initiated Renegotiation No
Insecure Client-Initiated Renegotiation No
BEAST attack Not mitigated server-side (more info)   TLS 1.0: 0xc014
POODLE (SSLv3) No, SSL 3 not supported (more info)
POODLE (TLS) No (more info)
Zombie POODLE No (more info)   TLS 1.2 : 0xc027
GOLDENDOODLE No (more info)   TLS 1.2 : 0xc027
OpenSSL 0-Length No (more info)   TLS 1.2 : 0xc027
Sleeping POODLE No (more info)   TLS 1.2 : 0xc027
Downgrade attack prevention No, TLS_FALLBACK_SCSV not supported (more info)
SSL/TLS compression No
RC4 No
Heartbeat (extension) No
Heartbleed (vulnerability) No (more info)
Ticketbleed (vulnerability) No (more info)
OpenSSL CCS vuln. (CVE-2014-0224) No (more info)
OpenSSL Padding Oracle vuln.
(CVE-2016-2107)
No (more info)
ROBOT (vulnerability) No (more info)
Forward Secrecy With modern browsers (more info)
ALPN Yes   h2 http/1.1
NPN No
Session resumption (caching) No (IDs assigned but not accepted)
Session resumption (tickets) No
OCSP stapling No
Strict Transport Security (HSTS) Yes   TOO SHORT (less than 180 days)
max-age=2592000
HSTS Preloading Not in: Chrome  Edge  Firefox  IE 
Public Key Pinning (HPKP) No (more info)
Public Key Pinning Report-Only No
Public Key Pinning (Static) No (more info)
Long handshake intolerance No
TLS extension intolerance No
TLS version intolerance No
Incorrect SNI alerts No
Uses common DH primes No
DH public server param (Ys) reuse No
ECDH public server param reuse No
Supported Named Groups secp384r1, x25519, secp256r1 (server preferred order)
SSL 2 handshake compatibility Yes
0-RTT enabled No


HTTP Requests
1 https://admin.srirameshwarmahadevmandirvikasnyas.in/  (HTTP/1.1 200 OK)
1
Cache-Control no-cache, no-store
Pragma no-cache
Transfer-Encoding chunked
Content-Type text/html; charset=utf-8
Server Microsoft-IIS/10.0
Strict-Transport-Security max-age=2592000
Set-Cookie .AspNetCore.Antiforgery.QXwjLzhzLJ0=CfDJ8E-u6848K8hBu5rvCiCsaVin_vvk9rIgjR15M5aqiFJNiauyszZ99CmXQvAq7gDLNl68cGf3M2OUlDTMT94br100da48sIVRMSpAQP9pJ4FGWOcWpkB96Hk_KcoROmB9KdovUxYq_f22exQHcto7Jns; path=/; samesite=strict; httponly
X-Frame-Options SAMEORIGIN
X-Powered-By ASP.NET
X-Powered-By-Plesk PleskWin
Date Thu, 19 Jun 2025 14:34:45 GMT
Connection close


Miscellaneous
Test date Thu, 19 Jun 2025 14:34:24 UTC
Test duration 241.949 seconds
HTTP status code 200
HTTP server signature Microsoft-IIS/10.0
Server hostname p3613.bom1.stableserver.net


SSL Report v2.4.0